SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019310m|PACid:19690282 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019310m|PACid:19690282
Domain Number 1 Region: 55-98
Classification Level Classification E-value
Superfamily F-box domain 0.000000000353
Family F-box domain 0.0097
Further Details:      
 
Domain Number 2 Region: 174-266,342-353
Classification Level Classification E-value
Superfamily RNI-like 0.00000994
Family 28-residue LRR 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si019310m|PACid:19690282
Sequence length 498
Sequence
MDDIAKMLARGLDFVMMNSTMLSLTKSAFTNIPHPPAATAVPLSGVVPARAPDGVDRISR
LPAGILRNIVSRLPVKDAARTTVLSTRWRRVWHTTPLVLVDAHLLPIASIGTSRSRLYSL
GADPRNLTDAVSTVLAAHPGPFRCIYLLGTPMEMRRDELALWLQHLAAKAVQKLIFVNRA
RTMKTEAHLPATLFRCTSLTKLYIGFWWFPETATLPRAVAFPYLRELGLFSLVMKEEDLA
FVLNRCPVLEKLVITGSPWPRLLLWEALGSGGLTDMSFKIKIGHAPMLRFLGFLVPGMYK
LDIGNTVIKAQTKASPNTTVPSVQMLAVQLKLGTRFDARMLPSFLRCFPNVKTLYVQSEN
DDYKFWGPQSYRLALANLISISGRRQGYIECVQRHIKKVVLREFRRTRSELDFLKFIAEH
AQVLEKMVLVLTHGHSPSDPIGTNLRTKLASAKWANACCELMIFQTPFHVEATAWCFLSA
FDLSNPDPLTFQNVSMGH
Download sequence
Identical sequences K3YYF8
Si019310m|PACid:19690282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]