SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019369m|PACid:19687947 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019369m|PACid:19687947
Domain Number 1 Region: 162-317
Classification Level Classification E-value
Superfamily RNI-like 0.00000000165
Family 28-residue LRR 0.088
Further Details:      
 
Domain Number 2 Region: 13-63
Classification Level Classification E-value
Superfamily F-box domain 0.00000000484
Family F-box domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si019369m|PACid:19687947
Sequence length 367
Sequence
MELNSRHSQKGEDEDRLSMLPDDVLLSILGRVDIATAARTSAVSTRWKHLPWLLRELTID
VKDFLPTPHPNPVEAQHMDAAMASLTKAIRSLLGSPQREATIITRRLQLKLYLVNGYSDA
VGPLLAEAIGTGSLKDLDLAILDEKEPVDCTSECMLHQACIVDGFFSACPSVIHCLTGLS
LDNVCFAEWDMQHLLLDCCKQLRRLFLSNCDMGMFSAWKIQAPGSHLEVLEVGCCCLGKL
EVLNLPKLERLCWDGWICPNAPLSLGVVPSLTELQLLCPANVTFQGFNLSDNLWLRPEGK
QLCSVLSRLRKLSLLDIFIEFDLLWMMVLLEAALSVEMFDVEIWEHPCIVDTEGRRQSYG
ERTSPWK
Download sequence
Identical sequences K3YYL5
Si019369m|PACid:19687947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]