SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019621m|PACid:19686739 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019621m|PACid:19686739
Domain Number 1 Region: 21-69
Classification Level Classification E-value
Superfamily F-box domain 0.000000994
Family F-box domain 0.011
Further Details:      
 
Domain Number 2 Region: 105-257
Classification Level Classification E-value
Superfamily RNI-like 0.0000385
Family Cyclin A/CDK2-associated p19, Skp2 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si019621m|PACid:19686739
Sequence length 404
Sequence
ESITCMSKEKKATTRHAKRSRYSGPNLPEDIWCHVHSLLSMRDSARVASVSHTFLRSWRH
HPNLIFSKETMGLKHNACEGGDIARAFTSEVYQILKKHSGTGVKTLEFDIFDCRNLSSCH
LNTWLQIAITPGIESLTLKLPLKYKERYSFPCSLLFGAKGNSIQHLHLTYCAFHPPIGID
FLRRLTKLYLREVLITEEDEKNLSMDCANESNFLCYAITNLPYIVPQVETIYLSSISEMV
NTPMPAAKFLHLKYLEVYLDGDLYAGYDYLSLVSFIDASPVLETFMFGVSGLDQRGMTSN
SVFESAAPLRQMPEHKHDSLKDSATSLERFTLDRVYDRLDKDNLGRCCVTSARKTGACCP
LTDEAILEAGRGLMAIDVYIMGRVPSTVKRDVRKPCSRCHTLQP
Download sequence
Identical sequences K3YZB3
Si019621m|PACid:19686739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]