SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019633m|PACid:19686937 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019633m|PACid:19686937
Domain Number 1 Region: 62-111
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000301
Family F-box domain 0.0054
Further Details:      
 
Domain Number 2 Region: 182-273
Classification Level Classification E-value
Superfamily RNI-like 0.0000122
Family Rna1p (RanGAP1), N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si019633m|PACid:19686937
Sequence length 363
Sequence
MDPQPIIGFSMREVRAYMERDGLDSRMLDFGMGLSLGVVYGSLPDPPVSPAAPLSPAGAG
CAPDGVDRISRLPEEVLRNVISHLPAKDAARTAALAWRWRGLWRSVPLALVDAHLLPDGG
AGGRPRDMLGRDSPGVAAAVSRVLTAHPGPFRCVHLTCSTMDAHRAEIARWLELLAAKGV
KELVFVNRPWPLDLRLPASLFSCTSLTCLHIGVWRLPDTAALPLAAGFPNLRELGLHIVL
MEDRDLAFLLDRSPVLETLVIFFAYQTEVRLRLVSRTLRCIQVCFSHFVDIAVVDAPCLE
RLLLWVTWGRGSEGSERSRVKIGHAPKLRVVRYLQLEMQGLEIGDTIIKVPFKLNCIHRV
LGF
Download sequence
Identical sequences K3YZC5
Si019633m|PACid:19686937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]