SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019668m|PACid:19690529 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019668m|PACid:19690529
Domain Number 1 Region: 37-187
Classification Level Classification E-value
Superfamily RNI-like 0.000000000247
Family Cyclin A/CDK2-associated p19, Skp2 0.016
Further Details:      
 
Weak hits

Sequence:  Si019668m|PACid:19690529
Domain Number - Region: 11-43
Classification Level Classification E-value
Superfamily F-box domain 0.00785
Family F-box domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si019668m|PACid:19690529
Sequence length 270
Sequence
MAASTPVTPNWANLPDDTLLTVFERLGSVDVLLGVCRSWLRVATGEPRLWRCVDLADCCF
DPTTDMEAMARAAVDRAAGCLEHFAADRFATSKLLRYIAKRTNCLKSLHLLTCMDFWYND
LVILGKRNPNLEELELTGCLPLFANRLHNNVLYDILDKCPHLESLDIHQCFNIEVDAALK
AKCSRLKGVKFPKDSTKDYEYETFVESTMPGSLTFQIDPPPPLPNYEYPSSDEDGECDDE
DCEDDVEDNERMMRIVRVMTITWNLLLVAL
Download sequence
Identical sequences K3YZG0
Si019668m|PACid:19690529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]