SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019709m|PACid:19690597 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019709m|PACid:19690597
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily F-box domain 0.0000567
Family F-box domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si019709m|PACid:19690597
Sequence length 247
Sequence
VAPSSLVALPTEVAIEIAGHLAATLERPMDDLHSLRETCLFMRRVCSDRAVGRRVALDRF
KHAMLWNKPARYAILPTRLTQVGNPKASFLTEMRVIFGETCSPQPCLDDLTRAATGEHNV
VAYLVALFLYMNNGGVGDDDTTRWYVRRVEGEEQSVASGDSKPTKMRMLSNKGCQLCHEQ
TAKVVHQTTWRKGGELLPPTLVHGDILCTGSSCGVTKGWPQITLFCSKDCRIHREIVLFQ
REIGIYN
Download sequence
Identical sequences K3YZK0
Si019709m|PACid:19690597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]