SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019731m|PACid:19686704 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019731m|PACid:19686704
Domain Number 1 Region: 4-60
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000628
Family F-box domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si019731m|PACid:19686704
Sequence length 289
Sequence
MEAAGTCEIARLPEELLSAALALTTPRDACRAAAVSRDFHASADSDAVWSRFLPRDPPPL
ADGELSGPAPPSEKGRFLRLCDRPVLLADGLMLTECCVQSMWLDRETGAKCYMLSARALR
ISWGDTPEYWRWMHPPESRFMEVAELQYVWWLEIRGMIHSKMLSQDSTYAAYIVFKTTDR
RDGLDYPPQEASITVAGSTSTHKVCLQSYDNEHEDGAVPLTWRYSRRHRRVFPGNLVIPQ
RRTDDWMELEMGQFYNKDGDDGEILGLEDVRIHFKFWQRKKRTYRICSH
Download sequence
Identical sequences K3YZM1
Si019731m|PACid:19686704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]