SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019765m|PACid:19690572 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019765m|PACid:19690572
Domain Number 1 Region: 12-50
Classification Level Classification E-value
Superfamily F-box domain 0.0000000706
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si019765m|PACid:19690572
Sequence length 195
Sequence
MLGIGLESFTVDHILTRVPAADTVRLQAVCREWRAAIASDRFVQAYQAVRAAAAQPPEII
FFASAKAGSTTFYREARELVTVGNLRANDVVLSGTKPCRGLTLLFQPSASAYHVCNLSAG
EHVSLHPCSPAWRDTPTMSPYVLSGAGLGFDPAANEHKVVRLYEDWENKQRCEVYGLRSG
GWRPCAGQVPPHAAK
Download sequence
Identical sequences K3YZQ5
Si019765m|PACid:19690572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]