SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019842m|PACid:19690110 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si019842m|PACid:19690110
Domain Number - Region: 6-42
Classification Level Classification E-value
Superfamily F-box domain 0.000392
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si019842m|PACid:19690110
Sequence length 308
Sequence
MLVVTEDKWSQLPPELVHLICYKFPDTGNFICFRAVCTSWKHRGPRLQDRQHIQFYRHSS
GKMYYVRVGGRSSWFLGNGAFQGHVIAIVDLVKTMLYNPLTSKAQAIRPAPYQPWLDGVF
QVLGDGDAGSMVVNTCTITRHFAYYRPGVHAGWNIFDERKDIRHNTYNGGRFFDNMVDGN
TLVIDATTRDVMTIVLAPSRDKFSTTLGDYLVASHRKILRALQYPLDGSQATGCSSLITM
AMGEPNNAAGLMRDCIYFTHKKRMWVRLCNYRSLCRYNIKCGRVDKTISLASCDDPGQIF
RINLNPSP
Download sequence
Identical sequences K3YZY1
Si019842m|PACid:19690110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]