SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019855m|PACid:19687055 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019855m|PACid:19687055
Domain Number 1 Region: 29-77
Classification Level Classification E-value
Superfamily F-box domain 0.000000000034
Family F-box domain 0.0063
Further Details:      
 
Weak hits

Sequence:  Si019855m|PACid:19687055
Domain Number - Region: 107-193
Classification Level Classification E-value
Superfamily NHL repeat 0.0144
Family NHL repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si019855m|PACid:19687055
Sequence length 387
Sequence
MESKTDRTEPTAPPSAASAAAISAVLGDDDLLREILLRLGFPTTLIRAAAVSKRWLRHAS
DPTFLRRFRTRHPPALLGFYIRELGARGPRFVPVSQAPELATATRRASAAEGRFFISDCR
NGRLLVMDFDPTACRHAVLSPLHPARGKVVLPPAPKQSLIWFFLTENGGGYDGAVAVLML
PIGTTKTKVQVDLLTSGSGVWVAHRTVVIDLPETLPPIAYTLPPVRGKIYSLTKSGHILG
LDMTAAKSSLIQRPDKVRTDNFMLSFGEEGSKLILIHAEGYLLSIWQLATTRSDSNDWVL
VYDKIRVHEAWNRLEDVMVMAADDNLEFVFLWLRSSAVLMHMHLKSRSEKVYDEFKVRDG
RFLDINPFMMVWPPVFPALREEDNVEG
Download sequence
Identical sequences K3YZZ4
Si019855m|PACid:19687055 XP_004952286.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]