SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019888m|PACid:19689470 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019888m|PACid:19689470
Domain Number 1 Region: 30-78
Classification Level Classification E-value
Superfamily F-box domain 0.0000523
Family F-box domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si019888m|PACid:19689470
Sequence length 370
Sequence
MEAKRERTEPTTAPPSAASAALVSVVLGNDDLLREILLRLIFPTTLVHAALIAKRWLRHA
SDPAFLCLFRARHPPALLGFYASQLDFSRPHIVPISQAPELATAIHRASFPGGHYLLVKD
CRNGRGLVLSSIDRVFHQLEVLDLLQPTGGVVLIPPPPPDCDCEADGIFLPDPGDGGEGG
EGVVAAQQITTDTVTAVYAEVTPPARGKIYMATDTGFVPVLDLAALGLSVLQLPNRVQPI
SLNLLYREYDSKLFLIHAEGFMLSIWHHKEDGNGAHNWVLVHDKIIVHEACIRHEHALLK
GADDNLEFVFLWLEASEVLVHILLKSRIEKVYDELTMRDKRYIGIKPFMMHVIPSVAMTF
PKVRFSSTIR
Download sequence
Identical sequences K3Z027
Si019888m|PACid:19689470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]