SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019917m|PACid:19686860 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019917m|PACid:19686860
Domain Number 1 Region: 18-75
Classification Level Classification E-value
Superfamily F-box domain 0.00000981
Family F-box domain 0.013
Further Details:      
 
Weak hits

Sequence:  Si019917m|PACid:19686860
Domain Number - Region: 179-282
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0131
Family Galactose oxidase, central domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si019917m|PACid:19686860
Sequence length 364
Sequence
MGPSRPPPPLPAAASAAAIEVILLRLSFPTYLIRAVVVSKCWLHHASDPTFLRRFIDLNP
PRLLGFYLTSLSHHQRRLADVIPMLPQPPKLTSITTPETICAGTLIFDRRGCFNLNGYEG
PTLRTVDCRNGRVFISLYHPAEYKFTRGVHTPLHCQGSESGYGLSYFWFTMEFIMNNRGS
HVYVYKLQDNVWHMLFSARTQLNCFAPRSPNNLIVEDKFYVAATRTSILVLDLTSSSYPT
IDLLDGVLNKGNTVLSRANDSGVYLVHLKELQRSIWLLRGTNGSMGDRSLVDTIFLRDMC
ANLGAVGDNAEFAFLDMGQCILYLDVRSRALRNVYEKNEYYDSDGCWIRPYMMSWPPIFP
VLKE
Download sequence
Identical sequences K3Z056
Si019917m|PACid:19686860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]