SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019934m|PACid:19688432 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019934m|PACid:19688432
Domain Number 1 Region: 55-98
Classification Level Classification E-value
Superfamily F-box domain 0.00000000103
Family F-box domain 0.0089
Further Details:      
 
Domain Number 2 Region: 178-333,372-396
Classification Level Classification E-value
Superfamily RNI-like 0.00000349
Family Cyclin A/CDK2-associated p19, Skp2 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si019934m|PACid:19688432
Sequence length 540
Sequence
MEDIAEMLVRGLDFFMMDSTMLSFTKSAFTNLPHPPAATDAPLSGAVPARAPDGVDRISS
LPAGTLRDIVSRLPVKDAARTTVLSKRWRRVWHTTPLVLVDAHLLPSAPIGTSRSRPFCL
RADPRDLFGGPRGLPDAVSTVLAAHPGPFRCVYLTGTPMETHRDELAFWLQHLAAKAVQE
LFFINRARTMDNDAHLPATLFRCTSLTKLYIGFWWFPETATLPRTVAFPYLRELGLFSLI
MKEEDLAFLLNRCPVLEKLLIDGSRWPVCLRIRSHSLRLVEMCQCLVAEITLAHASRLER
LLLWEAWGYGGDITNMSSKIKIGHAPKLRFLGFLVPGMHKLEIGNTIIKAETKASPNTIV
PSVQMLAVQVKLGTRIETRMLPSFLRCFPNVETLYVKSENDDYKFWGPQSTGAGKLNLKF
WKEAGYIECVQRHIKKVVLREFRGTRSELDFLKFIAEHAQVLEKMVIVLTHGHSPSDPIA
TNLRTKMASAKWANSCCELMIFQSPFHSEGTAWCYLAAFDLSNPEPFDVLKCIDGKCQSH
Download sequence
Identical sequences K3Z073
Si019934m|PACid:19688432 XP_012702368.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]