SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019952m|PACid:19688985 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019952m|PACid:19688985
Domain Number 1 Region: 172-292
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000262
Family Soluble quinoprotein glucose dehydrogenase 0.048
Further Details:      
 
Weak hits

Sequence:  Si019952m|PACid:19688985
Domain Number - Region: 10-48
Classification Level Classification E-value
Superfamily F-box domain 0.000209
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si019952m|PACid:19688985
Sequence length 333
Sequence
MLSSIMLVMPTVQWCELHTEIWGEIISHIDVLDVMSFSTTCKSLESVCKTLRATILKLGS
AILVTCQPDQDGLWTKDDLKTGKFGLHDIFNALSFCCVNEGLQRRIWLGGKGDWLVTTNT
SLDLEVLNPITRTKVPLPSFGNNLSGIELPSYREPNVIFPPFARDVAHVILSQTPSHTDG
YEAITLFSDGLLAYTAQGENIWRVLKNPTDHDDNAYNYYPKVLLDVIVYRGWVIAVEEDG
DIFAWDMSGPDLTPVHVPTPETTPSEEEVEHVFYLAISPSDQLILACLYGHVFGHNSNRN
KMVWNEHDRFEQLDSISMFGFDEANVTWSIHPL
Download sequence
Identical sequences K3Z091
Si019952m|PACid:19688985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]