SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019971m|PACid:19686325 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019971m|PACid:19686325
Domain Number 1 Region: 158-235,264-400
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000128
Family Cyclin A/CDK2-associated p19, Skp2 0.065
Further Details:      
 
Domain Number 2 Region: 16-74
Classification Level Classification E-value
Superfamily F-box domain 0.00000000183
Family F-box domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si019971m|PACid:19686325
Sequence length 423
Sequence
MLPEPHAGRATGAGDGDRLSALPDDILRVVLSILPARQAVQTTVLSPRWSGLWRSAPRVA
VDEREFGVSHSRRPREKWGRFESFATNLLASRCGSAPLDRFRLYAHGHVAPVDEWIQRGI
ECRPAALEIQTPYYPVEGHEFDPPHFAFPHLGSGFYGRLKTLRLVDVELDASFSELLSSD
CPALVDLELVGCANHFRRIASSTLEKLVIDSCYDCDDSGQPMLVVAPSLTTFKLHTANEG
WSFGISVCDAASLVKASISTEGSCCFPVNYLCKLLAGLSSVKTLELEGFDNLVTKLDSDK
LPMFPNMRALSLERCYIEDYDPHNMLEDLGRFLENALCLEKLTLRIILHKFCATNKPFCS
YPGMKWEPYWNSISLQCQSGKSFHCPKLKLIELRYNKGDHVPTELLWSMGKRLPNASITL
TKI
Download sequence
Identical sequences K3Z0B0
Si019971m|PACid:19686325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]