SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019993m|PACid:19688466 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si019993m|PACid:19688466
Domain Number - Region: 99-139
Classification Level Classification E-value
Superfamily F-box domain 0.000572
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si019993m|PACid:19688466
Sequence length 407
Sequence
MAKLASASRPPGRRRKQPRKTADDDPHKEEKHLLQPPSPAPAPAPLLRRRAGPSSTSTTL
HWGAKRWRTALGRRRDWSDLDDGPAGLIAERVLPATHGVVDYIRFRAVCRAWRRCCADPR
ARALLEDSRLHPRGWVMLLAEGEKLHAAAAPHRTRRRFLNVSTGQCIQVDVPELRDHGVL
RSTDEDGLLLLLRRKAATGGGVRLLNPLTRQVAELPLITGDDLLGFSPAHVGECSTSCAG
LVDGRWVFLYGHGSADGTTLAFAKPGRRRALLKTAGSLMPTMSFAGRFYGVTTDSVMVVD
STAMGGEDDPPPRLVVAAKLAARIRRMTDTAHLVDNGGELMLVHRRMRRVRGGADGEYGD
DYKRTCKVYRVNLAAGKATPAAAAAARGRAIFIDHSRALAVSPRVFP
Download sequence
Identical sequences K3Z0D0
Si019993m|PACid:19688466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]