SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si020007m|PACid:19688730 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si020007m|PACid:19688730
Domain Number 1 Region: 31-75
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000144
Family F-box domain 0.0078
Further Details:      
 
Domain Number 2 Region: 142-251
Classification Level Classification E-value
Superfamily RNI-like 0.00000133
Family 28-residue LRR 0.036
Further Details:      
 
Weak hits

Sequence:  Si020007m|PACid:19688730
Domain Number - Region: 301-368
Classification Level Classification E-value
Superfamily RNI-like 0.0298
Family Cyclin A/CDK2-associated p19, Skp2 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si020007m|PACid:19688730
Sequence length 442
Sequence
MPCREDARHMFDGMRLQKRSKDDEASTACGGTDRISGLPEGVLHHVLSLLPAHDAVRTCV
LARRWRHLWRSAPGIRITGVKGWRDADKFVAFVDRLLSLRGSCAPVESCKMKFDAGDFDF
DYFLLAKKQHVSHWIMDAVRLNVQVFRLSFAELESFCLPHLPLVSQHLVRLELACVDAND
SILDFSGCPALVVLRMKYCFVNAGKLLSASLKKLIMINCEFRRGNRTRISLPSLVSLELI
RCYGRTPLLECIPSLERAIVSLAGYSEDYCIDGGTGDCGDDSSEGCRYYYGSDGNRNNCV
FLKGLSEATHVELSACPGVFVFNRDLKWCPIFTKLKTLLLDEWCVADCNALICFLQHSPA
LEKLTLQLYMASQYPVKTDGRYNPLELPFASHHLKIVEIKCEEVDGRVHKILSSLNTYGI
PLNHIEIQQTNRSSGSGCKPNT
Download sequence
Identical sequences K3Z0E4
Si020007m|PACid:19688730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]