SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si020097m|PACid:19690009 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si020097m|PACid:19690009
Domain Number 1 Region: 5-73
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000157
Family F-box domain 0.0046
Further Details:      
 
Weak hits

Sequence:  Si020097m|PACid:19690009
Domain Number - Region: 225-360
Classification Level Classification E-value
Superfamily NHL repeat 0.00471
Family NHL repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si020097m|PACid:19690009
Sequence length 375
Sequence
MPQSPCAVIPVLPDELVVWEILVRLPAKALLRCRAVCGSWRRLTSDADFLLAHHRRQTSL
PLVFFRGQISVHVVGDALDAFDLRGDPATAERRPILRLPLHDFLFRQYKVYASCDGLLLF
SLCNRSFYICNPATRQRNALPSLIGTNVAGLYQHSPSGEYRILHRRRRYPELNSAYYILT
VGPYAKPRCIGLPAATVSASIKQYIAAGLLFVCGHPPVLLHSCLHWIVYSSQENALVVFD
TVSESFRCMSPPTENGQWQHLLDMDGALGISHMDESKVMVKLWVLQDYKTEVWSLKHQIE
LPMVELSVAMKCSFEVLVVSEKGDVLIYCSSFCHIFHCDSTGKLLHKFQWDRMLSMPTGY
WFKESLVRHAFFQGQ
Download sequence
Identical sequences K3Z0N1
Si020097m|PACid:19690009 XP_004952189.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]