SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si020106m|PACid:19687768 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si020106m|PACid:19687768
Domain Number 1 Region: 5-75
Classification Level Classification E-value
Superfamily F-box domain 0.00000000183
Family F-box domain 0.0076
Further Details:      
 
Weak hits

Sequence:  Si020106m|PACid:19687768
Domain Number - Region: 229-335,364-425
Classification Level Classification E-value
Superfamily NHL repeat 0.0575
Family NHL repeat 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si020106m|PACid:19687768
Sequence length 468
Sequence
MGLSELLPEDVLADVLRRLAPRWLATSRCVCRSWRATVDNRGLLSAVADLLPRTVAGIFL
QHSSTWMSSFLARPSVGPMVSADLDYTFSGDGDKIYDSFEVRDHCNGLLLLQNCVVNPAT
QQWAHLPPRPPLPCVGPDYFYADEYLVYDPTDSPYYEVFSILRVRRKFELSPRHQIPSLE
GSSFTFKKLDPALEELEWPPSPCVLHVFSSRTGRWERRSFVREGVAAGTIAHMRIDPYEH
RYAVYWRGALYVQCQTDFIMRLSLSSEKYQLIQLPVTFEPDGCSDEAYARRLSIGKSEKG
VYSVLVDENQIKVWILDDSDGQIKWVSKQLVVDLPKLQDKICCKSQSHGPWVLQGINFRI
DKARGFGNPATEQFEWDSDNDNLLPDNGNGTGYKHHITFLGFHPYKEVIFLNDSSVRVLA
YHLNSSKIQDIGYIYPEEDVYSLGNDRVWVERSFPYTPCWMRDFPQNV
Download sequence
Identical sequences K3Z0P0
Si020106m|PACid:19687768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]