SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si020121m|PACid:19688194 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si020121m|PACid:19688194
Domain Number 1 Region: 15-82
Classification Level Classification E-value
Superfamily F-box domain 0.0000206
Family F-box domain 0.0093
Further Details:      
 
Weak hits

Sequence:  Si020121m|PACid:19688194
Domain Number - Region: 172-285
Classification Level Classification E-value
Superfamily NHL repeat 0.0101
Family NHL repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si020121m|PACid:19688194
Sequence length 407
Sequence
DDETSTAKVLTNDGLVGEILLRLDCPACLVRAAIINKRWLHNASDQAIIRSFRAKQSPHL
LGIYVCSDDFSQPEFVPMPDASCPELAVALRHGNFNFPDMDSLLLNVWDCRNDGVLYEFG
ESIHAALAPAVRTPLRHPGEDTVVFPPQPSNTWPAECPHAMLLPDDDGDDSSCYRVDIGN
KNQKVYARVLVLRAGSWSIHCSALADLARSPEKILTVTLLMRGKIYMLTRAGYILALDLA
TARFSIVDLPEGVEFEYHGNLTSCRGDDSALYLFHVKGDKLTVWLKRMNEHGDDGSRNGD
WVLRDTISLLETCGHLVEQDCEPADGQEDGVSVVGVGDNAEFVFLEFVGTGVIVYMHLKS
RNVKKVYQRNPDNDFVIRVLPFVMVWPPIFPEHGADMKVTDCIKTQE
Download sequence
Identical sequences K3Z0Q4
Si020121m|PACid:19688194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]