SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si020153m|PACid:19686927 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si020153m|PACid:19686927
Domain Number 1 Region: 2-44
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000432
Family F-box domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si020153m|PACid:19686927
Sequence length 366
Sequence
MDVDMWASLPPELLVDIFRRLEAAAALRCTGVCKPWRRAIAGNAASCLRPRPDCRDRRRQ
HGALRTRSPAVSSFAQLGAATDLASYDELLASRDGLVLLGGRAVQDLCLWSLMTGDRKLL
PAGAFKDAYVLLTGYDLTVSDGGGGGDDDDDLKAVILAVKEKGIEGGMTYQIFSTSDGAW
GAVTVTRSHRFKKGLVTRIYPGSEVICRGGAVHWLGMATDAGVVECAVAVDVRSRRTWLT
DLPEGCGKLDCYSSLRTSPLRLATSGDGRLTVVRSFGGGLVEVWVLTGGDRWVLRRTIDV
RNLLPYCHGDVWFSACCPRSGCLLGHVGGKELLVCCLIECVDTNHGGCMYSLEMDWSTYM
AKMKRF
Download sequence
Identical sequences K3Z0T6
Si020153m|PACid:19686927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]