SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si020175m|PACid:19688851 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si020175m|PACid:19688851
Domain Number 1 Region: 118-392
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000188
Family Cyclin A/CDK2-associated p19, Skp2 0.066
Further Details:      
 
Domain Number 2 Region: 15-64
Classification Level Classification E-value
Superfamily F-box domain 0.000000589
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si020175m|PACid:19688851
Sequence length 455
Sequence
GITTSRNKRRASRNQQDKISGPSLPMDIWCHIHSLMPMRDAAQVACVSRAFARSWRGRPN
LTFSEETFGLNENTCQKDKLVRYFTNKAFNLEVYASYDEKNNCHLEHLDSWLQIAVKPGI
EELILSLFGIIGAKYNFPCSLFADGAGESLQYLFLASCEFHPTTKFGCLKSLTRLQLYMV
HIADGELECFLAGCVVVESLDLRYCSEIICLKIPCLQRLSFLEVSTCSNLEAIESKAPNL
SSFDFAGDLDVKLSLGNSPQIKKLRMRCKDATYYACTELPSKMPNLESLTIDSPTETVNA
PMLSSQFLHLKFLAIIVLDEMDYDFLSLGSSFFDASPSLETFFDASLQMMPRHHHDKLKR
VDITNFTSARTLVELACHIVESAKSLVRLTLDTTKGGPRCFGGNPYSCSLIRSRDAILEA
ERAVQAVEMYIKPKVSSTVELNVVEPCNRCRATEL
Download sequence
Identical sequences K3Z0V8
Si020175m|PACid:19688851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]