SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si020232m|PACid:19686852 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si020232m|PACid:19686852
Domain Number 1 Region: 95-152
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000366
Family F-box domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si020232m|PACid:19686852
Sequence length 216
Sequence
MKLRSDSSGGGDDHWTTAAAAAATGGGGSGEPSKKQRTEEPPSSSSGAGECSSSSASVQA
PPPPTQREPSAQDAREGEQPPPGADAEVGGEQERVPDLGEDLVFEVLMRAEARTLATAAC
VNRGWRQLARDERLWEAACVRECSNLGFSEQMLRMVVLSFGGFRRLYELYIRPVQRRAAG
APPGQRRGQVPMPNAPPPPKKDKDNDRDKNGGGQCG
Download sequence
Identical sequences K3Z115
Si020232m|PACid:19686852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]