SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si020618m|PACid:19688473 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si020618m|PACid:19688473
Domain Number - Region: 18-53
Classification Level Classification E-value
Superfamily F-box domain 0.0281
Family F-box domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si020618m|PACid:19688473
Sequence length 57
Sequence
MAAPAADEAWCRETVPRVLELVSPRLPQRDVCALLAVSPWCYRTLVSNPRLWEVRVA
Download sequence
Identical sequences K3Z250
Si020618m|PACid:19688473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]