SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si020924m|PACid:19693709 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si020924m|PACid:19693709
Domain Number 1 Region: 130-184
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000406
Family F-box domain 0.0067
Further Details:      
 
Domain Number 2 Region: 222-476
Classification Level Classification E-value
Superfamily NHL repeat 0.00000549
Family NHL repeat 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si020924m|PACid:19693709
Sequence length 516
Sequence
MDRVAGGGGRRSRRGSRGFGRSGPSAPVEGWTSATGSGMPTPAQDRDFDGGEQGRRGGRG
SERPTSVEPSSGGAAAGRASAAGRQSQRGGTMVWRPRRPQSPAQSGSAEGDADAAVSATS
PAVPAALDNEDILGEILLRLPPGPSSVPRAGAVCKRWRRLVADPGFLHRFREHHRKAPLL
GVLSHNRGKIGFTPVLDPPERIPAAGRFSLRLPRGSRVYGCRHGRVLVVTGKPFSFLVWD
PVTGDQCPVPLPSASGGNKYMIDGTVICASGDQGHVHGACHSSPFQVIFLGRCGDEIIVW
VYSSETGTWGDAISIMWLSPFDPDDFACCNTLVGNSIYWLFNESSMTILEFDLDTQRLAT
LEVPPEVIDLDTSVRDECQFLLMPTEDGELGFLILEGFNARIWKRKAKSDGDTGWVLRNT
IKLHLPLKRWAHGYPSEIIGFAEDCNVVFIATGGGVVFMVHLESAQFKKLPQKLGYRTCY
PFTSFCAAGKKLQIVMSGTIFKLSMVFVSIYVAGCL
Download sequence
Identical sequences K3Z306
Si020924m|PACid:19693709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]