SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si020952m|PACid:19701335 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si020952m|PACid:19701335
Domain Number 1 Region: 261-323,464-659,746-814
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000777
Family Quinoprotein alcohol dehydrogenase-like 0.033
Further Details:      
 
Domain Number 2 Region: 707-888
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0000126
Family Tricorn protease domain 2 0.05
Further Details:      
 
Domain Number 3 Region: 1215-1363
Classification Level Classification E-value
Superfamily ARM repeat 0.000093
Family Armadillo repeat 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si020952m|PACid:19701335
Sequence length 1751
Sequence
MSVWNYVVTAHKPTSVSHSCVGNFTSPNQLNLIIAKCTRIEIHLLTPQGLQPMLDVPIYG
RIATIELFRPHNETQDFLFIATERYKFCVLQWDTEKSELLTRAMGDVSDRIGRPTDNGQI
GIIDPDCRLIGLHLYDGLFKVIPFDNKGQLKEAFNIRLEELQVLDIKFLHGCVKPTIVVL
YQDNKDARHVKTYEVALKDKDFVEGPWSQNNLDNGAGLLIPVPAPLGGVIIIGEETIVYC
NANATFKAIPIKQSIIRAYGRVDPDGSRYLLGDNTGTLHLLVLTHERERVTGLKVEYLGE
TSIASSISYLDNGVVYVGSRFGDSQLVKLNLQADASGSFVEVLERYVNLGPIVDFCVVDL
DRQGQGQVVTCSGAFKDGSLRVVRNGIGINEQASVELQGIKGLWSLKSSFNDPYDMYLVV
SFISETRFLAMNMEDELEETEIEGFDAQTQTLFCQNVINDLLIQVTANSVRLVSCTSQEL
VDQWNAPAGFSVNVASANASQVLLATGGGHLVYLEIRDSKLVEVKHAQLEHEISCLDLNP
IGENPQYSSLAAVGMWTDISVRIFSLPDLELIRKENLGGEIVPRSVLLCTLEGVSYLLCA
LGDGNLFSFLLNASTGELTDRKKVSLGTQPISLRTFSSKGTTHVFASSDRPTVIYSSNKK
LLYSNVNLKEVNHMCPFNTAAFPDSLAIAKEGELSIGTIDDIQKLHIRTIPLNEQARRIC
HQEQSRTLAFCSFKYNQTSMEESETHYIRLLDHQTFEFLSTYPLDQYECGCSIISCSFAD
DNNVYYCVGTAYVLPEENEPTKGRILVFAVEDGRLQLIVEKETKGAVYSLNAFNGKLLAA
INQKIQLYKWMLREDGSHELQSECGHHGHILALYTQTRGDFIVVGDLMKSISLLVYKHEE
SAIEERARDYNANWMTAVEMLDDEAYIGAENSYNLFTVRKNSDAATDDERARLEVVGEYH
LGEFVNRFRHGSLVMRLPDSEIGQIPTVIFGTINGVIGIIASLPHDQYVFLEKLQSTLVK
FIKGVGNLSHEQWRSFHNDKKTAEARNFLDGDLIESFLDLSRGKMEEVSKAMGVPVEELS
KRVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDKAQVEQLLRYIMEEVPEDSE
KKRSFKFPFIACEIFTCEIDIILRTLVEDVELMDLLFSFVKPDHPHSTLLAGYFSKVVIC
LMLRKTAPLMNYVQEHPDIVVQLVDLIGITSIMEVLMRLIGADETIYSNFADTLQWLENT
DVLEMIVDKFSSSDSPEVHANAAEILSAVTRCAPPALAAKICSPSFVGRLFRHALEESRP
KSVLIVEFISVLLTIGSEIAEKELISQSAIKHCIDLFFQYPYNNFLHHHVENIIVSCLEV
KRNQLIDHVLNDCDLVGKVLAAEKKSSLSVDSNGPTLPSEGKEPPRIGNIGHITRIANKL
IQLGNSSSVIQNHLQENSEWAEWQTGVLVKRNEVENVYHWACGRPTSLHDRGRDSDDDDF
RDRDYDVAALANNLSQAFRYGIYSNDDIEEAQGSHERDDEDVYFDDESAEVVISSLRLGD
DQDSSSLFTNSNWFTFDGDRGINDRLAASVPSPSPNSEETTLSMEETDEVLIGEAPGTES
QLESVSLENGPVEETKELAEDAERNDEKLLCTEEENVSQEAEASERPMDVQDGQTDTQVG
SAAEASSTEGAADEPCSSSEPGNALPGALPQSADTENQSADPSGCSEIAHESGSPAEVDD
GKTVEVATTNE
Download sequence
Identical sequences K3Z334
Si020952m|PACid:19701335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]