SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si021404m|PACid:19698989 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si021404m|PACid:19698989
Domain Number 1 Region: 264-509
Classification Level Classification E-value
Superfamily RNI-like 6.28e-39
Family Cyclin A/CDK2-associated p19, Skp2 0.022
Further Details:      
 
Domain Number 2 Region: 62-377
Classification Level Classification E-value
Superfamily RNI-like 2.04e-36
Family Cyclin A/CDK2-associated p19, Skp2 0.027
Further Details:      
 
Domain Number 3 Region: 463-653
Classification Level Classification E-value
Superfamily RNI-like 5.1e-26
Family Cyclin A/CDK2-associated p19, Skp2 0.042
Further Details:      
 
Weak hits

Sequence:  Si021404m|PACid:19698989
Domain Number - Region: 17-54
Classification Level Classification E-value
Superfamily F-box domain 0.00828
Family F-box domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si021404m|PACid:19698989
Sequence length 665
Sequence
MSREGQRLYCAAAAGAGGVGIGVLSMDLLGQVLDRLREPRDRKACRLVSRAFERAEAAHR
RALRVLRWEPLPRLLRAFPALERLDLSACASLDDASLAAAVAGAGGGLAGLRRVCLARAS
GVGWRGLEALVAACPRLEAVDLSHCVGAGDREAAAVAAATGLKELRLDKCLAVTDMGLAK
VAVGCPRLEKLSVKWCREISDIGIDLLAKKCPELRSLDISYLQVGNGSLRSISTLEKLEE
LAMVGCSCIDDEGLELLSKGSDLLQSVDVSRCDHVTYQGLASLIDGRKFLQKLHAADCLH
EIGQHFLSKLATLKETLTVLKLDGLEVSDSLLQAIGEGCNKLFEIGLSKCSGVTDEGISS
LVARCSDLRAIDLTCCNFITNNALDSIADNCKMLERLLLESCSLINEKGLERIATCCSNL
KEIDLTDCGVNDAALQHLGKCSELQILKLGLCSSISDKGIAFISSNCGKLVELDLYRCNS
ITDDGLAALANGCKKIKLLNLCYCNKITDSGLGHIGSMEELTNLELRCLVRITGVGISSI
AIGCKSLIELDLKRCYSVDDACLGALARNAFNLRQLTISYCQVTGLGLCHLLSSLRCLQD
IKMVHLSWVSIEGFEMALRAACTRLKKLKMLTGLKTVLSPELLQMLQAYGCRIRWVNKPL
VYKDC
Download sequence
Identical sequences K3Z4D6
Si021404m|PACid:19698989 XP_004962795.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]