SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si021541m|PACid:19699255 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si021541m|PACid:19699255
Domain Number 1 Region: 115-250,300-358,424-542
Classification Level Classification E-value
Superfamily RNI-like 8.04e-29
Family 28-residue LRR 0.069
Further Details:      
 
Domain Number 2 Region: 24-56
Classification Level Classification E-value
Superfamily F-box domain 0.000000942
Family F-box domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si021541m|PACid:19699255
Sequence length 598
Sequence
MGGEAPEPRRLTRALSIGGGDGGWVPEEMLHLVMGFVEDPRDREAASLVCRRWHRIDALS
RKHVTVPFCYAVSPARLLARFPRLESLAVKGKPRAAMYGLIPEDWGAYARPWVTELAAPL
ECLKALQLRRMVVTDDDLAELVRARGHMLQELKLDKCTGFSTDGLRLVARSCRSLRTLFL
EECQIIDQGSEWIRDLAASCPVLATLNFHMTDLEVMPSDLELLARNCKSLISLKISDCDL
SDLIGFFQSATALEEFAGGTFNEQGELAKYGNVKFPSRLCSLGLTFMGTNEMPIIFPFSA
ILKKLDLQYTVLTTEDHCQLISKCPNLLVLAVRNVIGDRGLGVVADTCKKLQRLRIERGD
DEGGAQEEQGGVSQVGLTAIAVGCRELEYIAAYVSDITNGALESIGTFCKKLYDFRLVLL
DREERITELPLDNGVRALLRGCTKLRRFALYLRPGGLSDVGLEYIGQCSGNIQYMLLGNV
GETDDGLIGFALGCVNLRKLELRSCCFSERALALAMLHMRSLRYVWVQGYKASQTGRDLM
LMARPFWNIEFTPPNPENVQLNEDGEPCVDSQAQILAYYSLAGKRLDCPQSVVPLYPA
Download sequence
Identical sequences K3Z4S3
Si021541m|PACid:19699255 XP_004961907.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]