SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si021562m|PACid:19701213 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si021562m|PACid:19701213
Domain Number 1 Region: 83-231,282-405,462-545
Classification Level Classification E-value
Superfamily RNI-like 4.45e-34
Family Cyclin A/CDK2-associated p19, Skp2 0.033
Further Details:      
 
Domain Number 2 Region: 8-53
Classification Level Classification E-value
Superfamily F-box domain 0.00000013
Family F-box domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si021562m|PACid:19701213
Sequence length 590
Sequence
MGRGGSRAAPAAAMPPWHALPDEVWEHAFSFLPADSDRGAAAAACRSWLRAERRSRRRLA
VANCYAASPQDAVERFPSVRAVEVKGKPHFADFGLVPPGWGAAAAPWVAAAADGWPLLEE
LSFKRMVVTDDCLEMIAASFRNFQVLRLVSCEGFSTAGLAAIAAGCRNLRELDLQENEIE
DCSIHWLSLFPESFTSLVTLNFSCLEGDVNITVLERLVTRCRNLKTLKLNNSIPLDKLAS
LLRKAPQIVELGTGRFSADYHLDLFSKLEAAFAGCKNLRRLSGAWDAVPEYLPAFYCVCE
GLTSLNLSYATVRGPELIKFVSRCKNLQLLWVMDLIEDHGLAAVASSCNKLQELRVFPSS
PFDAAEQVSLTERGLVDVSAGCPMLESVLYFCRRMTNEALITIAKNRPNFTCFRLCIIEP
HTPDYITHQPLDAGFSAIVESCKGLRRLSVSGLLTDRVFKSIGAHADRLEMLSIAFAGNS
DLGLHYILSGCKSLKKLEIRDCPFGDKPLLANAAKLETMRSLWMSSCSLTLGACRQLARK
MPRLSVEVMNDPRRACPLDSLTDESPAETMYVYRTIAGPRSDTPTWVQIV
Download sequence
Identical sequences K3Z4U4
XP_004960270.1.39314 Si021562m|PACid:19701213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]