SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si021578m|PACid:19700617 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si021578m|PACid:19700617
Domain Number 1 Region: 287-545
Classification Level Classification E-value
Superfamily RNI-like 1.14e-19
Family Cyclin A/CDK2-associated p19, Skp2 0.049
Further Details:      
 
Weak hits

Sequence:  Si021578m|PACid:19700617
Domain Number - Region: 95-128
Classification Level Classification E-value
Superfamily F-box domain 0.000101
Family F-box domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si021578m|PACid:19700617
Sequence length 584
Sequence
MEKIATFASMVLASTTMEFTDQSPTECSVLRLDEQRPLTLPLLPYPRCRPGGPIRWLDCP
LQRTTAPTSSRHAAAVGGGGGVCRRPGCYAGTDAALCDDLLQEVFRLLPPAAAPAVSLVS
RRWLSLLRASTSSLTLRLPASPDAAPAAGTATLAALLSHYPFLSALTVVSAATPAGDADA
VLLAVAAAPAAARFSTLRLLPDSAVSPAALVAACPALSGLTSLHLTAVRPLSFRWLELLP
RLKSFALVNSAASVDYAGSSSDDAGGGEAEAAGALPLERLSLCGIRSGDRGLGWLWRRCG
SLKWLQLRACDGTGDGPASLAFAGCLAGLLALELRACRSVADRVLLLAADHCHALTSLLV
YDGGSSEALHRFIQQRAAGLHTLDLRLPLDLHNDHLLAIGAEPIHGGRDPKHSLVALRLQ
SCVLITGDGLRSLARTATGASIEELALVSCDVVEREPGLLTFLSQSMRRLRRLDLSYNET
LSDKVIGAMLSSCRNLIDIRLRGCRGLTGGSLVSLLRHCGQSLEILDLSRCPSIAVGNVE
LFAQRATRLNHMIIEESVISEELKAIAQKKGLKIGSLLPCEGPF
Download sequence
Identical sequences K3Z4W1
Si021578m|PACid:19700617 Si021579m|PACid:19700616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]