SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si021768m|PACid:19700085 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si021768m|PACid:19700085
Domain Number 1 Region: 92-135
Classification Level Classification E-value
Superfamily F-box domain 0.00000000903
Family F-box domain 0.01
Further Details:      
 
Domain Number 2 Region: 211-420
Classification Level Classification E-value
Superfamily RNI-like 0.0000000863
Family 28-residue LRR 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si021768m|PACid:19700085
Sequence length 519
Sequence
MDDAGEEGAGFTTYAQVEEYFNSLALDGPSAQERIDCIVPMLVSLLPPPYVPAPEVESDS
DDERFSLTSSDSEASDAGADHYAFAAAPGDGEDRISRLPDTLLADIIHRLPTKDAGRTAA
LSTHWRRVWAGTPLLVDDAHLLGAGGTSDVPVVRALSRCVAAHPGPVRGVRVTRVSFYAH
EYALRRLVADLAGKDVQDLILFNRPWPLDMPLPDDILRCASLDRLYLGVWHFPKTAAAHP
PAFPDLRELGLFHSLVPNQELEALLAHCPKLEVLSLVMSYNDPSRLRLASDSLKIAVDWM
SSFNEVVVEDAPSLERLLFESIGNRRPVKIVDAPRLEVLGALDLDLHTLEIGGTVIKAGI
NVSASNMVPSLKILAVKVQFACNREAKMLPTLLKCFPRLETLHIMPVPSDSPDSVHDLRF
WEHRGPCECLESHLETVIVHGVSLSEGHGVGFIRYIMRDGKALKTVAFVCSDEKVRGFRE
SAEGGSGEVAICMVAPRWSFRAAIDSSLDDPFYAVWAQA
Download sequence
Identical sequences K3Z5F0
XP_004961128.1.39314 Si021768m|PACid:19700085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]