SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si021897m|PACid:19699193 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si021897m|PACid:19699193
Domain Number 1 Region: 129-428,459-484
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 2.62e-17
Family Tricorn protease domain 2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si021897m|PACid:19699193
Sequence length 485
Sequence
MDGPKRQLRVRLRVTARRRGGGGDAADGGGAGAGAGGRKRRLDAPALNSAAKLQRREIGG
RQLAARGGGPAAAVPERFRNMRLQEEFDTYDANAHLFVKLQFLRRRSKIIEIVAAKDIIF
ALAHSGLCAAFNRVTNKRIAFLNLSPDEVIRSLFYNKNNDSLITVSVYASDNFSTLKCRT
TPIEYIRRNQLDAGFPLFESESLKWPGFVEFDDVNGKVLTYSAQDGIYKVFDLKNYSFLY
SIPDENVQEIKISPGIMLLIYDRTPSYVPLKILSIEDGKPLKFFKHLLHRNKKIDFIEQF
NEKLLVKQEDENFQILDVRTSELIEVGVSKFMTPSAFIFLYENNLFLTFRNRTIAVWNFR
GELVTSFEDHLLWHHDCSTNNIYITSDQDLIISYCKSEAVAEDGTVTPIGSINMSEIMTG
KCIAKIAAGDPALNVTPSRNSSKKRSSVWSTVPEALEDVTALFYDEDRNEIYTGNSQGLV
HVWSN
Download sequence
Identical sequences K3Z5S9
XP_004962954.1.39314 Si021897m|PACid:19699193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]