SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si021998m|PACid:19700618 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si021998m|PACid:19700618
Domain Number 1 Region: 102-456
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00000000000000144
Family Tricorn protease domain 2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si021998m|PACid:19700618
Sequence length 457
Sequence
MEPRRISASPRPCSGRRVVARKRPRQESVVSSVRKLQRREISSRRDRACAMTAAQERFRN
ITLQEEFDTHDPKENCLLLPYLRKRSKIIEIVAARDIVFALSQSGVCAAFSRETNQRICF
LNGSPDEVIRSLFYNKNNDSLITVSVYGSENFSALRCRTTRIEYIRRGQPDAGFSLFETE
SLKWPGFVEFDDVNGKVLTYSAQDSTYKVFDLKNYTLLYSVSDKNVQEIKISPGIMLLIY
TRTSSSVPLKILSIEDGTVLKSFSHLLHRNKKVDFIEQFNEKLLVKQEGENLQILDVRNF
QLTEVSRTEFMTPSAFIFLYELQLFLTFRNRSVAVWNFRGELVTSFEDHLLWHPDCNTNN
IYITSDQDLIISYCKADSTDSSSEENAGSINISSILTGKCLAKVNSGNGNSCKQKKAWKF
QNTVSEALEDITALYYDEERDEIYTGNRHGLVHVWSN
Download sequence
Identical sequences K3Z630
Si021998m|PACid:19700618 XP_004961717.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]