SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022138m|PACid:19698958 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022138m|PACid:19698958
Domain Number 1 Region: 166-415
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 6.54e-17
Family Galactose oxidase, central domain 0.028
Further Details:      
 
Domain Number 2 Region: 72-128
Classification Level Classification E-value
Superfamily F-box domain 0.000000000157
Family F-box domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si022138m|PACid:19698958
Sequence length 424
Sequence
MDAAVAVPARAARPTSPSRPPKTIRSTKPRGLDEDTAAPPAFPKGKASSSSAAAAPAAAL
LLHHHHADVPMDASVWAGLPDDLLLEVLARVPPFLLFRLRPVSRRWEAILRDPAFLAAHA
AVPSHGPCLLTFSRGGGGGAHSPPHCSVLSIPLHARYKLPFGFLPPWDLWLVGSSGGLVC
FSGFDGTTFRTVVCNPLTQAWRLLPDMHYNQQRQLVLTVDKSRRSFKVIAASDVYGDKAL
PTEVYDSNENKWSVHQMMPAANLCSSKMAFCDSRLYLETLSPLGLMMYRVDAGRWEHIPA
KFPRSLLDGYLVAGARTRLFLVGRIGLYSTLQSMRIWELDHGRTVWVEISRMPPRYFRAL
LRLSAERFECFGQDNLICFTSWNQGKGLLYDVDKKSWSWIAGCASQLCNSQVCFYEPRFD
TSIY
Download sequence
Identical sequences K3Z6G9
XP_004960220.1.39314 Si022138m|PACid:19698958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]