SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022141m|PACid:19701013 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022141m|PACid:19701013
Domain Number 1 Region: 16-100
Classification Level Classification E-value
Superfamily F-box domain 0.00000000262
Family F-box domain 0.01
Further Details:      
 
Domain Number 2 Region: 120-225,256-411
Classification Level Classification E-value
Superfamily RNI-like 0.000000102
Family Cyclin A/CDK2-associated p19, Skp2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si022141m|PACid:19701013
Sequence length 424
Sequence
MDRGGSQKKRHKSVANVDIISNLPDVIKDKILCCLPIKEAVGTCLLSRKWRYTWASMTEL
TFREDDFDLGNGIEEGESNKFVYFIIMVLSLHNGPILKFELNVRRVHLLSPGGHIHRWML
MLSRNGVKEIQIRTKIWRNYKIPSSFFSCEELEYACLQGCVFQLPPVFTGFKRIHTLHFI
DFCATENNIGELVASCPNLEKLVLSRLLSFADIIIHSTKLKILRVDGMFKHLSLVTPHVS
SAAINLQVNTGYVPRAGCNFNLSQFIGSLLDIENISLLGHAFECAAHGILPGKLPRLLNR
LTEITLGIDLGNLKEANAAHCLFQVAPNLRCLELQLIYRGYGTPTSNFWDSIDHQSGLFN
NLDTVVLNNFAGSCAESGFLKLLLEDAPVLRIAQIKDNNKLDKESLRRLLKMRRASKDAE
VILL
Download sequence
Identical sequences K3Z6H2
XP_004962085.1.39314 Si022141m|PACid:19701013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]