SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022193m|PACid:19700353 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022193m|PACid:19700353
Domain Number 1 Region: 16-78
Classification Level Classification E-value
Superfamily F-box domain 0.00000000432
Family F-box domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si022193m|PACid:19700353
Sequence length 410
Sequence
MSEDLAGSRRWRCDLGGDDRWLSGAAGDDHFDRLPDALLLVIFNRIGDVKALGRCSIVSR
RFHELIPLVDSVLVRVDCVIPDEPPSSSSPSAPSSPTASVRARGVFSQIARIVLGGIVKP
IQALGQILSPANSASGFSASSASSSSSFSPSSTSYSPLPPGDVSHHSPSEVLRSFKELRH
LRIELPSGELGTDDGVMLKWKADFGSTLGSCVILGASSASPSSAGSDGTSTAPSVDSGRS
EPDECDDSGSIPESFYTNGGLRLRVVWTISSLIAAAGRHYLLQPIVADHTTLESLDLTDA
DGQGVLTMDKCQLQELRVRPVSTSAASHRTLMPELSMWLWYAPCIELPGGLVLNGATLVA
IKPSEEATKDMVGNGASVATWVLDAFEEPYRTAARMLLKRRTYTLEMNSF
Download sequence
Identical sequences K3Z6M4
XP_004961549.1.39314 Si022193m|PACid:19700353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]