SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022197m|PACid:19699949 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022197m|PACid:19699949
Domain Number 1 Region: 13-73
Classification Level Classification E-value
Superfamily F-box domain 0.00000000785
Family F-box domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si022197m|PACid:19699949
Sequence length 409
Sequence
MGQVLPVPGAREPPAPALPNHLIEEVLVRIATPRDLVRASAACASFRRTVADASFLRRYR
TLHRPLLLGILSPWGLLPAEAPHPNAHVADALSRDTYFSPDHLPPRGRPGWLRSDSRDGR
VLRMFYEPKDGTVLPELLVADPLTRGYTLLPPIPESLVASLLGPVCPKLVGDFDAFFVPS
GDYEEEHFRVIGWTRDEAMAVAFVYSSLSGTWTAGTRAFWGELGLNVCPEEGMLLLADRW
PSYAYGCFYWKVFESNKFLKLDVNRMEFLAVRLSPNHEKQQVIVAEAGEGRIGIVSLTFG
REITQSLRYSIRQNEGEIANKHPVETTIPLPSDYDEYWVVAAAEGYIFLLGARYISQGGT
STHCVGSSEFLTLEIKTLKIERVCSARGGVCGHIIPYFGFPPFMSLRRI
Download sequence
Identical sequences K3Z6M6
Si022195m|PACid:19699950 Si022197m|PACid:19699949 XP_004960769.1.39314 XP_004960770.1.39314 XP_012699757.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]