SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022200m|PACid:19698025 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022200m|PACid:19698025
Domain Number 1 Region: 12-56
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000017
Family F-box domain 0.0071
Further Details:      
 
Weak hits

Sequence:  Si022200m|PACid:19698025
Domain Number - Region: 254-385
Classification Level Classification E-value
Superfamily YWTD domain 0.00641
Family YWTD domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si022200m|PACid:19698025
Sequence length 408
Sequence
MDHPKRSAAAAPSLPDDALVEILSRVPAKSLCRFKCVSRAWRDLIADRLRCNRLPQTLEG
FFYVFDGDDETQGGSSDAGGVSPDRAVHGRFINTLGKPSPLASFSFLGKVPGIEEFGLLR
SCNGLLLFGHRRAGDSYDSLGYIVCNPATEQWVAVPSSGWGPDYNDESEDSDSDTETSCT
FTYLVFDPAASSHFQLVQFWVDDTSRVEAVHTYSSETGVWCERLSTWGDDFVAFFAGSAF
VGGMLHFSNTSYFGWEIDQELIVAVDGEGGICRVISGPQKLCDVAFVGQSQGRLHYMNQH
GDSTGDMTGLSIWVLQDYDTEEWVLKHSVTFMQLFRRMSCRVQYDYSVIAIHPDRNLIFF
FQHWNLELKSYDMDSEEVCTLHTLGVCPHNILPYVPYFAESSALAGKH
Download sequence
Identical sequences K3Z6N1
XP_004963244.1.39314 XP_012700110.1.39314 Si022200m|PACid:19698025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]