SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022256m|PACid:19698402 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022256m|PACid:19698402
Domain Number 1 Region: 17-79
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000124
Family F-box domain 0.0051
Further Details:      
 
Domain Number 2 Region: 129-370
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00000017
Family Galactose oxidase, central domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si022256m|PACid:19698402
Sequence length 396
Sequence
MSEGTTSPALEPEPAPLPDNDDIHREIFLRLPPLPSSVPRASLVCKRWRRLLSDPAFLRR
FRAHHRAPPLLGFFADEDGDIEFVPTLRRPDRIPAARFSAPRKDDGDHLSFLGCRHGLAL
LVDRAQLEAVVWNPVTGTRRRVPFPPGFNQGHVYKGAVLSSSGDGHVHGDCRLIPFKLVL
VHHAELHGSVATACLYESESREWGNVCSTAIPRLSLHQPGVLVGNQIYWMLSGTSDILEF
DLDGQSLSVIQKPEDAHVTNNSGLQALRTQDNKLGLATVSKLGIQLWERKTNSDGFGRWV
PLKTVELDKLLSISPSIRIRSATILGFDEDSNAFFICTNMGIYMIQLESLQFTKLFDGDC
FTAYYPYTSFYTAGLGIGGGDSRAEMLNNTLSQYIL
Download sequence
Identical sequences K3Z6T7
Si022256m|PACid:19698402 XP_004962323.1.39314 XP_004962324.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]