SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022268m|PACid:19699287 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022268m|PACid:19699287
Domain Number 1 Region: 147-267
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.000000000000106
Family Actin/HSP70 0.0094
Further Details:      
 
Domain Number 2 Region: 42-123
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000628
Family F-box domain 0.0027
Further Details:      
 
Domain Number 3 Region: 261-326
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.000000013
Family Actin/HSP70 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si022268m|PACid:19699287
Sequence length 393
Sequence
MAMLLRKVWGSVLARAALGAPGPGPAAPGSPRGGRRAQPAAERYSASLSLGALDAVPTDV
LAQILRLLGPVDAARSTAVCRAWRILASDNGLWAFFLRLGPDPWDLVVFAETHLAAGPDS
HPWLYYDNSPQLSFKQIYGLRAVVPGTLIVDGGSGYCKYGWSKYAAPSGRCATFLEFGNI
ESPMYARLRHFFSTIYTRMQVKPSTQPVIVVLPLNHTDDTDSARASRKQYKETIYSVLFD
MNVPAVCAVDQAVLSLYASKRTSGIVVHIGFNTTSVVPIFEGRVMYEIGVETVGQGALKL
TGFLKELMHQRNISCESLYTVRTIKEVHKLLVRLMVKGGSLCRKRDSRLLKFYFSPTWEE
CLLWACIKQYLYVWITAIIQKWLVMTAGTRRLF
Download sequence
Identical sequences K3Z6U9
Si022268m|PACid:19699287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]