SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022295m|PACid:19698042 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022295m|PACid:19698042
Domain Number 1 Region: 22-64
Classification Level Classification E-value
Superfamily F-box domain 0.000000000249
Family F-box domain 0.0069
Further Details:      
 
Weak hits

Sequence:  Si022295m|PACid:19698042
Domain Number - Region: 141-325,353-382
Classification Level Classification E-value
Superfamily RNI-like 0.000102
Family Cyclin A/CDK2-associated p19, Skp2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si022295m|PACid:19698042
Sequence length 390
Sequence
MAPLTRQRKKALAAAAGPSIAPADRLGALPDDALRRILGFLPAKDVVRTCVLGRHWRHLW
KSASGLRIGSAEEPAACGDKLMEFVGSLLQARGGSPLETTPKLNHETNLLNLINPSLVNG
YYEPDINRWIRHAVMCHVRVLFLGFSRTLHWFEVVSLPLVSQHLARLVLFMLELNGNFLD
FSSCSVLEQLEIDHCRLQSVNRISSQSLKSLSIIGFSVLACSFHTQIRSPNLISLHMECI
TGRAPVLERMPSLVEAVVDINLSQAKKLVLSANIEMIIFRRDLIWCPIFSNLKTLLLNEY
WCVPGDLSALACILEHSPVLEKLTLQLFCEGSKSKVQIKGSPDPAKRSTAISEHLKIVEI
KCEVLDQKIQNVLEFLSKLNIHSYSLHFEE
Download sequence
Identical sequences K3Z6X5
Si022295m|PACid:19698042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]