SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022328m|PACid:19698993 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022328m|PACid:19698993
Domain Number 1 Region: 22-69
Classification Level Classification E-value
Superfamily F-box domain 0.0000102
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si022328m|PACid:19698993
Sequence length 383
Sequence
MGGHQAEEEGGGARAKRSAPRAAGGETASSLSALADDVLLQILGRLEGDPRDWARASCAS
PRLAALLRAACLPPRLSRALPAELLPAPPPDGAPAAWAALHKLSVCCPGLLRAGVLLEPT
DDFGLELDIGPDFPIRALAGDSAAAASVEGLEATATSRDRTADAVARGGDGDSTDAAWSL
YDDLYLDAAYDCSSEPQIPPAAAAPDPGPPPAAPAIRDAEEEEEAAATDASCSVARRGVV
AGSRRHPRRWLGTVGAHLASGSWTLSREQGNKLLASRFRGDQLYLCDWPGCVHAEERRKY
MVFRGVFHNFARSQVRRALRDTRRPTVAVDCAFCGSKEAWDLYSAFCLRSFYGYHDDGEP
VVRAYVCENGHVAGAWTKRPLYS
Download sequence
Identical sequences K3Z708
Si022328m|PACid:19698993 XP_004962311.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]