SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022393m|PACid:19702207 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022393m|PACid:19702207
Domain Number 1 Region: 4-49
Classification Level Classification E-value
Superfamily F-box domain 0.00000000484
Family F-box domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si022393m|PACid:19702207
Sequence length 372
Sequence
MDAGEDCISGLPDELLHAILVRLGSTRAAVRTGVLSRRWRHVWASLPELVLEERVDAPPP
PASFLDTVDAALAACDAPALERLSIALRAEYGGGVLAGRIEPWLRFASERVVGALFLYVP
PRILPFFEPEVDGEEAAVLELPASGGVTGMDLSLGGPWRLRPPSSGFELTSLVCTQCPCL
RDPNLLIMLVDASNLSVRSESLQSLWFSVWKTRQLEIVASRLEKLSVSNAIDEARISALK
LAELSWSNAAYDPRCHQFDDVGHRLRLLELGQSSTVASLMQQFDEVDELKLGISIPQGID
GYESFLNATNKLPKCKILSISSAWEHHGLVPGMLHLLRSCNSTRKLSLFDCYLYMGIFLI
LVAPWFELLIVV
Download sequence
Identical sequences K3Z773
Si022393m|PACid:19702207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]