SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022413m|PACid:19702187 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022413m|PACid:19702187
Domain Number 1 Region: 80-349
Classification Level Classification E-value
Superfamily RNI-like 4.32e-39
Family Cyclin A/CDK2-associated p19, Skp2 0.0018
Further Details:      
 
Domain Number 2 Region: 30-76
Classification Level Classification E-value
Superfamily F-box domain 0.0000068
Family F-box domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si022413m|PACid:19702187
Sequence length 369
Sequence
MVSGRPVSGELDAWFESLMVSSGSQRGHAESGGPLPTLSGWKDLPVELLLRILSTIGDDR
MVIVASGVCTGWRDALGWGVTRLSLSWCKLNMNNLMISLAPKFTKLQVLTLRQNKPQLED
SAVEAVANYCHDLRELDLSRSFRLSDRSLYALAHGCPWLTRLNISGCSNFSDTALTYLTC
RCKNLKCLNLCGCVKAASDRALQAIAQNCGQLQSLNLGWCDDVTDKGVTSLASGCPDLRA
VDLCGCILITDESVVALANGCPHLRSLGLYFCQNITDRAMYSLANSCMKSKRRRWDAVKD
GLANLNISQCTALTPPAVQAVCDSFPALHTCPERHSLIISGCLSLTSVHCACALHPHRAG
RALMLNHAY
Download sequence
Identical sequences K3Z793
Si022413m|PACid:19702187 Si022416m|PACid:19702186 XP_004962027.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]