SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022414m|PACid:19701430 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022414m|PACid:19701430
Domain Number 1 Region: 7-73
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000157
Family F-box domain 0.0052
Further Details:      
 
Weak hits

Sequence:  Si022414m|PACid:19701430
Domain Number - Region: 118-278
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000484
Family Galactose oxidase, central domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si022414m|PACid:19701430
Sequence length 369
Sequence
MASPRPPPELMADLVVEILLRLPPADPACLIRASVVCKSWLRLTSDANFLRRYRAFHGAP
PPLLAFLSNTRGKNEPRLVPFTEPTPFKPPAFDCSRRPWVMDCRHGRALLFDMWADSEGA
LAVWDPITGDRQILPKPGCGRHVSAAAVLCAAGAGCDHLDCHGGPFLVVCLGISATHGGV
VDAHVYSSEAGSWGALASVQLGLDSYGRMNCGLVIRDEVYFTLKFSARILKYSLGTNAFS
LIGVPVDIQFVLTRTEDDSLGLASVRDSNLYLWSRKDNLEGVAGWVNCRVIKLQAPFSTH
DRFATSVIGFAEGVDVILVTANAMFAVELKSGKVTKVGRPGDYYSALPIMGFYTPDCGRR
NHRHGLADF
Download sequence
Identical sequences K3Z794
Si022414m|PACid:19701430 XP_004962664.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]