SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022635m|PACid:19702208 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022635m|PACid:19702208
Domain Number 1 Region: 4-49
Classification Level Classification E-value
Superfamily F-box domain 0.00000000392
Family F-box domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si022635m|PACid:19702208
Sequence length 329
Sequence
MDAGEDCISGLPDELLHAILVRLGSTRAAVRTGVLSRRWRHVWASLPELVLEERVDAPPP
PASFLDTVDAALAACDAPALERLSIALRAEYGGGVLAGRIEPWLRFASERVVGALFLYVP
PRILPFFEPEVDGEEAAVLELPASGGVTGMDLSLGGPWRLRPPSSGFELTSLVCTQCPCL
RDPNLLIMLVDASNLSVRSESLQSLWFSVWKTRQLEIVASRLEKLSVSNAIDEARISALK
LAELSWSNAAYDPRCHQFDDVGHRLRLLELGQSSTVASLMQQFDEVDELKLGISIPQVCL
YQQSLLKSNCFSDYSVATLSLLVTGNRWL
Download sequence
Identical sequences K3Z7W5
Si022635m|PACid:19702208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]