SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022923m|PACid:19701482 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022923m|PACid:19701482
Domain Number 1 Region: 117-152
Classification Level Classification E-value
Superfamily F-box domain 0.0000000837
Family F-box domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si022923m|PACid:19701482
Sequence length 277
Sequence
MPVRRRQPRRQETGAAERYREMGIAAALSRPWDYPTACGELAALLRLGYVDLPKAAQALV
ASDVLLAFRLLPDVQTGYALSAANALLQAVEVALPKQKKAQAVSEFKHSVIAHKRRARVQ
QNSGLPHIPHDVLVHIFSFLDMHSLVAAGLVCCIPVSGVQNSRDLVQSSMDLVSIGPSFR
WKESFHSKYTECASWKFASNRALCGHCRSVIWLSNLTCTSPHHCPKNGRDEIKLQPLLPD
TVAKYILHNDDLAASSSESDDTDDSDYENGHPRFWTF
Download sequence
Identical sequences K3Z8Q3
Si022923m|PACid:19701482 XP_004961433.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]