SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022993m|PACid:19699389 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022993m|PACid:19699389
Domain Number 1 Region: 129-198
Classification Level Classification E-value
Superfamily RNI-like 0.000000471
Family 28-residue LRR 0.089
Further Details:      
 
Domain Number 2 Region: 11-49
Classification Level Classification E-value
Superfamily F-box domain 0.00000425
Family F-box domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si022993m|PACid:19699389
Sequence length 262
Sequence
MEAAAAKQARTARGSAPDRLSALSDELLCHVLSFLPSRQAVQTTVLSKSSSDFRGGHWWR
KLQDFTNNLLMLNNARCLDAFRLDLFWATEFPDLCRDTERWVRRGIKCQPPVFQIRVYRD
IFRYHFQIPRLGSGFHLLKSLELAFLDNELDKFPMFDNLRTLSLSYCFFSERDADKLKAL
GRFLHKSPNLEELILQDFWLPKVSMGRKGKAKLKKTYPRFGNLVRFQCRKLKYTEIIYEK
GVKIQELVSFLRASQALQQKII
Download sequence
Identical sequences K3Z8X3
Si022993m|PACid:19699389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]