SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si023110m|PACid:19701103 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si023110m|PACid:19701103
Domain Number 1 Region: 7-86
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000497
Family F-box domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si023110m|PACid:19701103
Sequence length 239
Sequence
MELSPAPVPAGRWADLPEDIAVAVASRLQEADVCALGGCSRSWRTACDADCVWERLFRCR
WPAAAAEAAVASRVQGWKALYMNQHRRMAVAISNVVEFVGSSLNNGSLESEYYLKAIADL
ALIADIGFLDVQFFLFSRNHSAIINLIGLHYSISSLHVPPTEVSKALQACQVAGRKVCVN
LLKLGRWFYGFRLRDEHESRKISLNELTMSEGAEVLAILNRGAVHEVFRLRVSLADMDK
Download sequence
Identical sequences K3Z989
XP_004962273.1.39314 Si023110m|PACid:19701103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]