SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si023270m|PACid:19699390 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si023270m|PACid:19699390
Domain Number 1 Region: 131-197
Classification Level Classification E-value
Superfamily RNI-like 0.00000196
Family 28-residue LRR 0.089
Further Details:      
 
Domain Number 2 Region: 11-49
Classification Level Classification E-value
Superfamily F-box domain 0.00000278
Family F-box domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si023270m|PACid:19699390
Sequence length 204
Sequence
MEAAAAKQARTARGSAPDRLSALSDELLCHVLSFLPSRQAVQTTVLSKSSSDFRGGHWWR
KLQDFTNNLLMLNNARCLDAFRLDLFWATEFPDLCRDTERWVRRGIKCQPPVFQIRVYRD
IFRYHFQIPRLGSGFHLLKSLELAFLDNELDKFPMFDNLRTLSLSYCFFSERDADKLKAL
GRFLHKSPNLEELILQDFWMIFCY
Download sequence
Identical sequences K3Z9P9
Si023270m|PACid:19699390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]